A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10081
Swiss-prot Accession number	Q9U8R2 (Sequence in FASTA format)
Description	Androgenic gland hormone precursor (Arv-AGH) [Contains: Androgenicgland hormone B chain; Androgenic gland hormone A chain].
Source organism	Armadillidium vulgare (Woodlice) (Pillbugs)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Peracarida; Isopoda; Oniscidea; Armadillidiidae;Armadillidium.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	N/A
Tissue Specificity	Androgenic gland
Post translational modification	N/A
Function	Controls sex differentiation and the formation of male appendages, spermatogenesis, pigmentation, and male specific behavior
Protein Length	144 Amino acids
Molecular weight	16893
References	1  PubMed abstract 10529379 2  PubMed abstract 10411634
Domain Name	N/A
Hormone Name	Androgenic gland hormone B chain
Mature Hormone Sequence	YQVRGMRSDVLCGDIRFTVQCICNELGYFPTERLDKPCPWPNRE
Position of mature hormone in Pre-Hormone protein	44 Residues from position (22-65)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10082
Swiss-prot Accession number	Q9U8R2 (Sequence in FASTA format)
Description	Androgenic gland hormone precursor (Arv-AGH) [Contains: Androgenicgland hormone B chain; Androgenic gland hormone A chain].
Source organism	Armadillidium vulgare (Woodlice) (Pillbugs)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Peracarida; Isopoda; Oniscidea; Armadillidiidae;Armadillidium.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	N/A
Tissue Specificity	Androgenic gland
Post translational modification	N/A
Function	Controls sex differentiation and the formation of male appendages, spermatogenesis, pigmentation, and male specific behavior
Protein Length	144 Amino acids
Molecular weight	16893
References	1  PubMed abstract 10529379 2  PubMed abstract 10411634
Domain Name	N/A
Hormone Name	Androgenic gland hormone A chain
Mature Hormone Sequence	EIAFYQECCNIRTEHKCNRTTVSLYCRTY
Position of mature hormone in Pre-Hormone protein	29 Residues from position (116-144)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10167
Swiss-prot Accession number	P83627 (Sequence in FASTA format)
Description	Vitellogenesis-inhibiting hormone (VIH).
Source organism	Armadillidium vulgare (Woodlice) (Pillbugs)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Peracarida; Isopoda; Oniscidea; Armadillidiidae;Armadillidium.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the arthropod CHH/MIH/GIH/VIH hormone family.
Tissue Specificity	Found in the sinus glands of both male and female. Found also in the brain; the neuroendocrine structures of the protocerebrum
Post translational modification	N/A
Function	Inhibits secondary vitellogenesis in females. Has no hyperglycemic or molt-inhibiting activity
Protein Length	83 Amino acids
Molecular weight	9491
References	1  PubMed abstract 10480992 2  PubMed abstract 12679090
Domain Name	Crust_neurohorm
Hormone Name	Vitellogenesis-inhibiting hormone
Mature Hormone Sequence	YNIPLGWGRRDMPGCLGVLGNRDLYDDVSRICSDCQNVFRDKNVESKCRSDCFSTSYFETCIMALDLAEKISDYKLHASILKE
Position of mature hormone in Pre-Hormone protein	83 Residues from position (1-83)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10581
Swiss-prot Accession number	P30814 (Sequence in FASTA format)
Description	Crustacean hyperglycemic hormone (CHH).
Source organism	Armadillidium vulgare (Woodlice) (Pillbugs)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Peracarida; Isopoda; Oniscidea; Armadillidiidae;Armadillidium.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the arthropod CHH/MIH/GIH/VIH hormone family.
Tissue Specificity	Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. Found also in the brain; in the neuroendocrine structures of the protocerebrum
Post translational modification	N/A
Function	Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction
Protein Length	73 Amino acids
Molecular weight	8736
References	1  PubMed abstract 8436119 2  PubMed abstract 12679090
Domain Name	Crust_neurohorm
Hormone Name	Crustacean hyperglycemic hormone
Mature Hormone Sequence	RIFDTSCKGFYDRGLFAQLDRVCEDCYNLYRKPHVAAECRRDCYTTEVFESCLKDLMMHDFINEYKEMALMVS
Position of mature hormone in Pre-Hormone protein	73 Residues from position (1-73)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated